Open Syllable Exceptions: The Full List & Rules
Free Word List Syllable Tool

Open Syllable Exceptions: The Full List & Rules

An open syllable ends in a vowel with nothing after it, which keeps the vowel long — but a small, learnable set of words breaks that pattern on purpose. Browse every open syllable exception below, or check any word instantly with our free Syllable Counter.

227
Total Words
6
Exception Patterns
100%
Free Download
0
Sign-ups
↓ Download All 227 Open Syllable Exceptions

What Is an Open Syllable? (Quick Review)

An open syllable is a syllable that ends with a vowel — one vowel, with no consonant closing it in. Because nothing follows the vowel, it’s free to say its own name: the long vowel sound. This is one of the six syllable types most reading and spelling programs teach, and it’s usually introduced right alongside its counterpart, the closed syllable.

Open Syllable vs. Closed Syllable

The easiest way to tell open and closed syllables apart is to look at what comes after the vowel. In an open syllable, nothing does — the syllable ends with a vowel, as in go or hi. In a closed syllable, one or more consonants follow the vowel and close it in, as in hot or twist, which shortens the vowel sound instead. Closed syllables are actually the more common syllable type in English, and they have their own set of irregular words — we cover those separately in closed syllable exceptions, words like kind and told that end in a consonant but still carry a long vowel sound.

Open SyllableClosed Syllable
Ends withA vowelA consonant
Vowel soundUsually longUsually short
Examplego, she, hicat, hop, twist

Example Open Syllable Words

Regular open syllable words follow the pattern reliably: go, she, hi, no, flu, and the first syllable in words like music and tiger. In each case the vowel sits at the end of the syllable with nothing following it, so it keeps its long vowel sound. It’s only a smaller subset of words that don’t play by this rule — and that subset is what this page maps out in full.

What Are Open Syllable Exceptions?

An open syllable exception is a word that technically meets the definition of an open syllable — it ends with a vowel and nothing follows it — but doesn’t produce the long vowel sound a reader would expect. These aren’t random misspellings; each pattern has a phonetic explanation rooted in stress, word origin, or how English spelling evolved over centuries.

Why These Words Break the Rule

Most open syllable exceptions come down to one factor: stress. English vowels behave differently depending on whether the syllable carrying them is stressed or unstressed. When a syllable isn’t stressed, its vowel often relaxes into a schwa — that flat, quick “uh” sound — instead of holding its full long vowel sound. This single mechanism explains the majority of the words on this list, from sofa to the final syllable in banana. A second group of exceptions comes from letter y acting as a vowel, which shifts sound depending on where it falls in the word. A third, smaller group traces back to Old English and early borrowed spellings that never lined up cleanly with modern phonics rules, which is why words like to and do still trip readers up today.

Are There 3, 4, 5, or 6 Patterns?

Ask three different phonics programs how many open syllable exception patterns exist, and you’ll likely get three different answers. Many introductory programs teach just two: the schwa exception and y as a vowel, since those two alone account for most exception words a beginning reader will encounter. A more complete accounting — the one used on this page — adds two more patterns: open i words that say long e (like ski and taxi), and open o or u words that say oo instead of a long vowel sound (like to and who). The y-as-vowel pattern also splits into two distinct behaviors depending on stress: a stressed final y almost always says long i, whether the word has one syllable (sky) or several (supply, July), while an unstressed final y softens to long e (baby, candy). Counted that granularly, there are six trackable patterns in total, plus a small handful of high-frequency sight words irregular enough to be taught on their own.

The Full List of Patterns and Words

Filter by pattern, search for a specific word, or download the complete list below. Together these categories cover 227 open syllable exceptions in English — the most complete list of its kind.

Schwa Exception — Unstressed Final “A” (52 words)

sofazebrabananacameracommapandagorillavanillaumbrellaareaideaalpacaiguanakoalaplazapizzasodacolaarenaaromadramaextraoperayogaagendaantennacinemacomadiplomaenigmaeraformulagalakarmalavallamamamapanoramapapaparkapastaplasmaquotasalivasalsasaunastigmatraumatunaultravistavisa

Y as a Vowel — Long “I” Sound, One-Syllable Words (17 words)

bymywhytrycrydryflyfryshyskyspyslyplystywryprythy

Y as a Vowel — Long “I” Sound, Stressed Final Syllable (45 words)

applycomplydenydefyimplymultiplyoccupyrelyreplysatisfysupplyclassifyclarifynotifyverifyamplifysimplifyqualifyquantifyspecifyjustifymodifysignifyterrifyhorrifyglorifymagnifypurifyratifyrectifypacifytestifybeautifyexemplifyidentifyJulyallyawrystandbynearbytherebywherebydragonflybutterflyfirefly

Y as a Vowel — Long “E” Sound, Unstressed Final Syllable (85 words)

babycandypuppyfunnyhappyluckypartycitystoryfamilytwentythirtyhungryangryemptycherryberrymarrycarryhurryworrydirtysunnypennyshinyeasybusycrazylazytinycurlysillytidyuglywindymuddyreadychillyjellyjollyyummykittysmellybellysorrygloryivorymemoryhistoryfactoryvictorycountrycenturyenergyanymanyveryeveryonlydutybeautycountyfortyfiftysixtyseventyeightyninetyplentythirstydustyrustymistyfoggysoggybuggysandyhandyrockytrickystickycheekyfreakysneakyleaky

Open “I” Saying Long “E” (12 words)

skikiwitaxibroccolispaghettizucchinibikinimacaroniconfettisalamitsunamikhaki

Open “O”/”U” Saying “OO” (8 words)

todowhointowhomundoredoado
Showing 85 words of 85

Printable Word List

Download the full list as a single printable sheet — organized by pattern, sorted alphabetically within each group, and formatted for classroom or homeschool use — with the download button above.

Why Do These Words Exist? (The History)

Most open syllable exceptions aren’t spelling mistakes; they’re leftovers from how English absorbed vocabulary from other languages over hundreds of years. Words like sofa, banana, and pizza were borrowed from Arabic, Spanish, and Italian, and their spelling was largely kept intact even though English stress patterns don’t match the original pronunciation. Other exceptions go back even further: words like to and do descend from Old English, where vowel sounds have shifted dramatically over the centuries while the spelling stayed frozen in place. That’s also why phonics instruction treats these as a specific, learnable exception category rather than asking students to guess.

“Exceptions to the Exceptions”

Sofa vs. Aha (Stressed vs. Unstressed Final “A”)

Not every word ending in an open a falls into the schwa exception. The difference is stress. In sofa, the final a is unstressed, so it softens to a schwa. But in a word like aha or spa, that final a is stressed, so it holds a fuller, more open vowel sound rather than reducing to schwa. The rule of thumb: check whether your voice naturally emphasizes that last syllable. If it does, it’s probably not a true schwa exception.

Sky (Long “I”) vs. Baby (Long “E”) — Why Y Changes

The y-as-vowel pattern splits cleanly along syllable count. In one-syllable words, y is the only vowel and carries the full stress, so it says long i — as in sky, cry, and fly. In multisyllabic words, the final y sits in an unstressed syllable, so it relaxes toward long e instead — as in baby, candy, and party. Once a reader knows to check syllable count and stress, this pattern becomes fully predictable rather than a rule to memorize word by word.

High-Frequency Sight Word Exceptions

The, Of, Was — Why Beginning Readers Learn These by Sight

A handful of extremely common words don’t fit neatly into any phonics pattern, open or closed, which is why they’re usually taught as sight words rather than sounded out. The ends in an open syllable but is pronounced with either a schwa or a long e sound depending on what follows it. Of looks like it should end in a short vowel sound but is instead pronounced with a v sound and a short u. Was similarly defies its spelling. These words are irregular enough, and used often enough, that most early literacy programs teach them for instant recognition well before a student is ready to decode them by rule.

When to Teach This Concept

Recommended Grade Level and Scope & Sequence

Open syllable exceptions are typically introduced in 1st grade, after students are already comfortable identifying basic open and closed syllables in one-syllable words. In structured programs like Wilson Reading, this concept generally appears in Level 1, once a student has mastered closed syllables and short vowel sounds and is ready to apply the open syllable rule to two-syllable words. Introducing exceptions too early — before the base rule is automatic — tends to create more confusion than clarity.

What Students Need to Know First

Before tackling exceptions, a student should be able to reliably identify an open syllable, apply the rule that a vowel followed by nothing says its long sound, and contrast that against a closed syllable, where a vowel followed by a consonant says its short sound. Basic phonemic awareness should already be solid, since much of learning these exceptions depends on a student noticing that what they’re hearing doesn’t match what the spelling predicts.

Tips for Teaching Open Syllable Exceptions

Multisensory Tapping (Orton-Gillingham Method)

Have students tap out each sound in a word like sofa while saying it aloud, then compare the tapped sounds to the syllable division on paper. The physical mismatch between what’s tapped and what’s expected helps make the exception concrete rather than abstract — a core technique in Orton-Gillingham-based instruction.

Mnemonics

Short, memorable phrases help lock in irregular patterns. For the schwa exception, something like “the sleepy A” (it’s too tired to say its full name) gives students a quick mental hook. For y as a vowel, “short word, long I; long word, long E” is easy to repeat and apply on the fly.

Word Sorts, Chaining, and Word Puzzles

Have students sort word cards into pattern categories — schwa, long-i y, long-e y, and so on — which builds pattern recognition faster than a static list. Word chaining and simple word puzzles reinforce the same skill in a lower-stakes, game-like format.

Activities for Teaching with Decodable Texts and Readers

Once a pattern has been introduced, decodable text that deliberately includes exception words gives students practice applying the rule in context rather than in isolation. This is also a good moment to point out that not every unfamiliar word needs to be sounded out letter by letter — recognizing a familiar exception pattern lets a struggling reader decode faster and with more confidence.

Resources: Worksheets, Printables, and Where to Find Them

Beyond the printable list above, most structured literacy and science of reading curricula include dedicated worksheets for open syllable exceptions as part of their broader phonics program. Look for materials that separate exception words by pattern rather than mixing them into a single undifferentiated list, since students learn the categories faster when they’re kept visually distinct.

More Syllable Word Lists

Frequently Asked Questions

Is “sofa” an open syllable exception?

Yes. The second syllable in sofa ends in a vowel with nothing after it, which is the definition of an open syllable, but because that final a is unstressed, it softens into a schwa sound instead of the long a a reader would expect.

Why does “sky” say long i but “baby” say long e?

Both words use y as an open-syllable vowel, but position changes the sound. In a one-syllable word like sky, y is stressed and says long i. In a two-syllable word like baby, the final y is unstressed and softens toward long e instead.

Are “to” and “do” open syllable exceptions?

Yes. Both words end in a single vowel with nothing following it, so they qualify as open syllables, but instead of the expected long o or long u sound, they’re pronounced with an oo sound, making them common sight-word exceptions.

What’s the difference between an open syllable exception and a closed syllable exception?

An open syllable exception is a word that ends in a vowel but doesn’t produce the expected long vowel sound, such as sofa or to. A closed syllable exception is the opposite: a word that ends in a consonant but still produces a long vowel sound, such as kind or told.

How many open syllable exception patterns are there?

Most phonics programs teach two core patterns — the schwa exception and y as a vowel — but a fuller list also includes open i words that say long e, like ski and taxi, and open o or u words that say oo, like to and who, bringing the total to four or five patterns depending on how a program groups them.

Put it into practice

Once a pattern clicks, the fastest way to make it stick is to test it against real words. Paste any word into our free Syllable Counter to check its syllable breakdown instantly, or head back to the full open syllable words list to see the base rule these exceptions are measured against.